This research aims to develop a precise and efficient dispersive solid-phase microextraction (DSPE) technique using third-generation polyamidoamine (PAMAM) dendrimer-grafted nanoparticles to quantify benzoylurea pesticides in green tea, black tea, and oolong tea infusions. The extraction efficiency is optimized through single-factor adjustments of key parameters, including adsorbent quantity (5-20 mg), adsorption duration (5-20 min), desorbent identity (methanol, acetonitrile), volume (100-600 μL), sodium chloride concentration (0-10%, m/v), and sample solution pH (3-8). The optimized method demonstrates linearity in the range of 2-500 μg L-1, with limits of detection (LODs) ranging from 0.6-1.5 μg L-1 and limits of quantification (LOQs) from 2.0 5.0 μg L-1. Recovery rates of 81.2-96.0% are achieved, with intra-day relative standard deviations (RSDs) of 1.4-2.8% and inter-day relative standard deviations of 2.0-3.9%, indicating high accuracy and repeatability. The successful application of detecting residues in commercial tea samples underscores the strong potential of the technique to determine benzoylurea analyte levels. solidphase solid phase DSPE (DSPE thirdgeneration third generation PAMAM (PAMAM dendrimergrafted dendrimer grafted infusions singlefactor single factor parameters 520 5 20 (5-2 mg, mg , mg) min, min min) methanol, methanol (methanol acetonitrile, acetonitrile acetonitrile) 100600 100 600 (100-60 μL, μL μL) 010%, 010 0 10%, 10 (0-10% m/v, mv m/v m v m/v) 38. 38 3 8 . (3-8) 2500 2 500 2-50 L1, L1 L 1, 1 LODs (LODs 0.61.5 0615 0.6 1.5 6 0.6-1. L- LOQs (LOQs 2. 50 5. L1. 1. 81.296.0% 812960 81.2 96.0% 81 96 81.2-96.0 achieved intraday intra day RSDs (RSDs 1.42.8% 1428 1.4 2.8% 4 1.4-2.8 interday inter 2.03.9%, 2039 3.9%, 9 2.0-3.9% repeatability levels 52 (5- 10060 60 (100-6 010% 01 10% (0-10 (3-8 250 2-5 61 0.61. 061 06 0. 15 0.6-1 296 81.296.0 81296 812 81. 960 96.0 81.2-96. 42 1.42.8 142 14 28 2.8 1.4-2. 03 2.03.9% 203 39 3.9% 2.0-3.9 (5 1006 (100- (0-1 (3- 25 2- 0.61 0.6- 29 81.296. 8129 96. 81.2-96 1.42. 1.4-2 2.03.9 3.9 2.0-3. ( (100 (0- (3 81.296 81.2-9 1.42 1.4- 2.03. 3. 2.0-3 (10 (0 81.29 81.2- 2.03 2.0- (1

The present study analyzed the chemical composition and phytotoxic activity of Artemisia lancea essential oil (EO). Gas chromatography-mass spectrometry (GC-MS) results showed the presence of 55 compounds, representing 82.36% of the entire EO, with eucalyptol (18.7%) being the most abundant constituent. Phytotoxic bioassay results indicated that the EO (concentration ranging from 0.25-5 mg mL−1) inhibited the growth of Amaranthus retroflexus and Setaria viridis. Root length of A. retroflexus and S. viridis were reduced with the increasing concentration of the EO, especially when the EO was applied at 1-5 mg mL−1. When treated with 1-5 mg mL−1 EO, shoot length of A. retroflexus and S. viridis were also significantly suppressed. The half maximal inhibitory concentration (IC50) values for inhibiting root and shoot growth of A. retroflexus by the EO were 0.284 and 0.246 mg mL−1; for S. viridis, the EO showed IC50 values of 0.44 and 0.262 mg mL−1 for root and shoot inhibition, respectively. The most promising findings were observed when A. lancea EO concentration reached 1 mg mL−1 and higher, which completely inhibited seed germination of A. retroflexus and S. viridis. These findings suggest A. lancea EO has potential as an eco-friendly bioherbicide for agricultural weed control. EO. . (EO) chromatographymass chromatography mass GCMS GC MS (GC-MS 5 compounds 8236 82 36 82.36 18.7% 187 18 7 (18.7% constituent 0.255 0255 0.25 0 25 0.25- mL1 mL A S 15 1- mL− suppressed IC (IC50 0284 284 0.28 0246 246 0.24 IC5 044 44 0.4 0262 262 0.26 inhibition respectively higher ecofriendly eco friendly control (EO 823 8 3 82.3 18.7 (18.7 255 025 0.2 2 (IC5 028 28 024 24 04 4 0. 026 26 82. 18. (18. 02 (IC (18 (1 (

Coal spontaneous combustion in longwall gobs is a major concern in coal mines. In comparison to other hazards, this phenomenon is difficult to detect. Fifteen factors influencing coal spontaneous combustion in longwall gobs were identified from the literature. The logical relationships between these factors were evaluated and quantified by decision-making trial and evaluation laboratory (DEMATEL) and interpretive structural modelling (ISM) methods. A four-level hierarchical structure model was established. The research shows that combining DEMATEL and ISM can reveal the key factors that influence coal spontaneous combustion in longwall gobs and establish the interactions and relationships among these factors. The results can provide the basis for preventing and controlling coal spontaneous combustion in longwall gobs.

ABSTRACT Introduction: Atrial fibrillation is one of the common complications of mitral valve disease. Currently, in the absence of freezing equipment, it’s still impossible to fully conduct a minimally invasive Cox-maze IV procedure to treat atrial fibrillation. Methods: We analyzed the clinical data of 28 patients who underwent thoracoscopic minimally invasive mitral valve full maze surgery in our hospital from October 2021 to September 2022; 13 patients were male and 15 were female, three suffered from paroxysmal atrial fibrillation, and 25 suffered from permanent atrial fibrillation; average age was 61.88±8.30 years, and mean preoperative left atrial diameter was 47.12±8.34 mm. Isolation of left atrial posterior wall (box lesion) was completed in all patients by cut-and-sew technique and bipolar clamp ablation. Results: For these subjects, the median cardiopulmonary bypass time was 169 (109.75-202.75) minutes, aortic cross-clamping time was 106 (77.75-125.50) minutes, and ventilator assistance time was 6.5 (0-10) hours. Among them, eight subjects had the endotracheal tubes removed immediately after surgical operation. Three subjects were in the blanking period; two subjects still had atrial fibrillation at three months after operation, one of whom resumed sinus rhythm after electrical cardioversion therapy; and all the remaining 23 subjects had sinus rhythm. Conclusion: The minimally invasive cut-and-sew technique for electrical isolation of left pulmonary veins can improve sinus conversion rate of patients suffering from both mitral valve disease and atrial fibrillation. In selected subjects, it is safe and has good results in the short-term postoperative period. Introduction Currently equipment its s Coxmaze Cox Methods 2 202 2022 1 female 6188830 61 88 8 30 61.88±8.3 years 4712834 47 12 34 47.12±8.3 mm box lesion cutandsew cut sew ablation Results 16 109.75202.75 1097520275 109.75 202.75 109 75 (109.75-202.75 minutes crossclamping cross clamping 10 77.75125.50 777512550 77.75 125.50 77 125 50 (77.75-125.50 65 6 5 6. 010 0 (0-10 hours them operation period therapy Conclusion shortterm short term 20 618883 3 61.88±8. 471283 4 47.12±8. 75202 109.75202.7 109752027 10975 109.7 20275 202.7 7 (109.75-202.7 75125 77.75125.5 77751255 7775 77.7 12550 125.5 (77.75-125.5 01 (0-1 61888 61.88±8 47128 47.12±8 7520 109.75202. 10975202 1097 109. 2027 202. (109.75-202. 7512 77.75125. 7775125 777 77. 1255 125. (77.75-125. (0- 6188 61.88± 4712 47.12± 752 109.75202 1097520 (109.75-202 751 77.75125 777512 (77.75-125 (0 618 61.88 471 47.12 109.7520 109752 (109.75-20 77.7512 77751 (77.75-12 ( 61.8 47.1 109.752 (109.75-2 77.751 (77.75-1 61. 47. (109.75- (77.75- (109.75 (77.75 (109.7 (77.7 (109. (77. (109 (77 (10 (7 (1

Abstract To study the propagation and evolution of one-dimensional elastoplastic waves within the system under rectangular, trapezoidal, and half-sine incident waves, leveraging elastoplastic incremental wave theory and numerical simulation calculations, the research qualitatively investigates the distribution and evolution of the stress field within the specimen, the impact of Bar 2 parameters, and the deformation characteristics of Bar 2 under these three types of incident waves. The findings indicate: Regardingthe overall stress uniformity of Bar 2 during the entire loading phase, the rectangular incident wave is the most effective, while the half-sine and trapezoidal waves are more advantageous for analyzing the stress conditions in Bar 2 during the early loading phase. The diameter and dimensionless density of the specimen significantly influence the stress non-uniformity, showing an approximate negative and positive correlation, respectively. onedimensional one dimensional halfsine half sine calculations parameters indicate phase effective nonuniformity, nonuniformity non uniformity, non-uniformity correlation respectively

ABSTRACT Objective: To investigate the effect of improving the operative field and postoperative atelectasis of single-lung ventilation (SLV) in the surgical repair of coarctation of the aorta (CoA) in infants without the use of cardiopulmonary bypass (CPB). Methods: This was a retrospective cohort study. The clinical data of 28 infants (aged 1 to 4 months, weighing between 4.2 and 6 kg) who underwent surgical repair of CoA without CPB from January 2019 to May 2022 were analyzed. Fourteen infants received SLV with a bronchial blocker (Group S), and the other 14 infants received routine endotracheal intubation and bilateral lung ventilation (Group R). Results: In comparison to Group R, Group S exhibited improved exposure of the operative field, a lower postoperative atelectasis score (P<0.001), reduced prevalence of hypoxemia (P=0.01), and shorter durations of operation, mechanical ventilation, and ICU stay (P=0.01, P<0.001, P=0.03). There was no difference in preoperative information or perioperative respiratory and circulatory indicators before SLV, 10 minutes after SLV, and 10 minutes after the end of SLV between the two groups (P>0.05). Intraoperative bleeding, intraoperative positive end-expiratory pressure (PEEP), and systolic pressure gradient across the coarctation after operation were also not different between the two groups (P>0.05). Conclusion: This study demonstrates that employing SLV with a bronchial blocker is consistent with enhanced operative field, reduced operation duration, lower prevalence of intraoperative hypoxemia, and fewer postoperative complications during the surgical repair of CoA in infants without the use of CPB. Objective singlelung single (SLV (CoA . (CPB) Methods 2 aged months 42 4. kg 201 202 analyzed S, , S) R. R R) Results P0001 P P<0.001 0 001 (P<0.001) P=0.01, P001 P=0.01 01 (P=0.01) (P=0.01 P=0.03. P003 P=0.03 03 P=0.03) P>0.05. P005 P>0.05 05 (P>0.05) bleeding endexpiratory expiratory PEEP, PEEP (PEEP) Conclusion duration (CPB 20 P000 P<0.00 00 (P<0.001 P00 P=0.0 (P=0.0 P>0.0 (P>0.05 (PEEP P<0.0 (P<0.00 P0 P=0. (P=0. P>0. (P>0.0 P<0. (P<0.0 P=0 (P=0 P>0 (P>0. P<0 (P<0. P= (P= P> (P>0 P< (P<0 (P (P> (P<

Resumo Gardenia jasminoides Ellis é um fitoterápico chinês com valor medicinal e econômico, mas seu mecanismo de resposta ao estresse hídrico permanece obscuro. Neste estudo, o “método de potes duplos” foi usado para simular o estresse hídrico de G. jasminoides Ellis e explorar seu mecanismo de resposta fisiológica e transcriptômica. Não encontramos danos significativos aos lipídios da membrana de G. jasminoides Ellis durante o estresse. POD desempenhou um papel antioxidante vital, o enriquecimento KEGG mostrou que metabólitos secundários, como flavonoides, também podem desempenhar um papel antioxidante e PRO desempenhou um ajuste osmótico significativo. Os hormônios endógenos regulam o crescimento e o desenvolvimento de G. jasminoides Ellis e desempenham um papel na transdução de sinal. Entre eles, o estresse hídrico leve é retardado. Ao mesmo tempo, havia 19631, 23693 e 15045 genes diferencialmente expressos de G. jasminoides Ellis nos dias 5, 10 e 15 sob estresse hídrico. Esses genes foram intimamente associados ao proteassoma, endopeptidase, ribossomo, transdução de sinal MAPK e transdução de sinal de hormônio endógeno, interação planta-patógeno e biossíntese de fenilpropanoides e outras vias fisiológicas e metabólicas, que regulam o turnover e transporte de proteínas, o reforço e adesão das paredes celulares, a indução do fechamento estomático, reações alérgicas, reações de defesa, movimentos foliares, entre outros. Também podem absorver os raios ultravioleta para reduzir a geração de radicais livres de oxigênio, alterar a forma de utilização da energia e ajustar a pressão osmótica das células vegetais.

Abstract Gardenia jasminoides Ellis is a Chinese herbal medicine with medicinal and economic value, but its mechanism of response to waterlogging stress remains unclear. In this study, the “double pots method” was used to simulate the waterlogging stress of Gardenia jasminoides Ellis to explore its physiological and transcriptomic response mechanism. We found no significant damage to Gardenia jasminoides Ellis membrane lipid during stress. POD played a vital antioxidant role, KEGG enrichment showed that secondary metabolites such as flavonoids might also play an antioxidant role, and PRO played a significant osmotic adjustment. Endogenous hormones regulate the Gardenia jasminoides Ellis's growth and development and play a role in signal transduction. Among them, light waterlogging stress is delayed. At the same time, there were 19631, 23693, and 15045 differentially expressed genes on the 5th, 10d, and 15d of Gardenia jasminoides Ellis under waterlogging stress. These genes were closely associated with the proteasome, endopeptidase, ribosome, MAPK signal transduction, and endogenous hormone signal transduction, plant-pathogen interaction and phenylpropanoid biosynthesis and other physiological and metabolic pathways, which regulate the turnover and transportation of protein, the reinforcement and adhesion of cell walls, the induction of stomatal closure, allergic reactions, defense reactions, leaf movements and others. It also can absorb ultraviolet rays to reduce the generation of oxygen free radicals, change the way of energy utilization and adjust the osmotic pressure of plant cells.

ABSTRACT: Quinoa (Chenopodium quinoa) has earned special attention worldwide due to its higher nutritional value and its adaptive ability to contrasting environments. Here, it was explored how quinoa seed germination is regulated. CqNLP1 gene was identified and cloned due to its higher expression level in quinoa seeds. The role of CqNLP1 in seed germination was studied based on model species as Arabidopsis sp. The function of NO3 - during seed germination of quinoa was analyzed. The results showed CqNLP1 gene can restore the germination rate of Arabidopsis mutant nlp8-1 and nlp8-2 strains, suggesting that CqNLP1 gene plays an important role in promoting seed germination. Appropriate level of NO3 - could improve the germination rate of quinoa seeds, promote the decomposition and utilization of soluble protein and ABA, increase the expression level of CqNLP1 and CYP707A2 during germination. The optimal NO3 - concentration to promote seed germination is 1mM. ABSTRACT Chenopodium environments Here regulated CqNLP seeds sp NO analyzed nlp81 nlp nlp8 1 nlp8- nlp82 2 strains ABA CYPA CYP A CYP707A 1mM mM

RESUMO: A quinoa (Chenopodium quinoa) tem ganhado atenção especial em todo o mundo devido ao seu maior valor nutricional e à sua capacidade de adaptação a diferentes ambientes. Nesse estudo, foi explorado como a germinação das sementes de quinoa é regulada. O gene CqNLP1 foi identificado e clonado devido ao seu maior nível de expressão em sementes de quinoa. O papel do CqNLP1 na germinação de sementes foi estudado com base em espécies modelo como Arabidopsis sp. A função do NO3 - durante a germinação de sementes de quinoa foi analisada. Os resultados mostraram que o gene CqNLP1 pode restaurar a taxa de germinação das cepas mutantes nlp8-1 e nlp8-2 de Arabidopsis, sugerindo que o gene CqNLP1 desempenha um papel importante na promoção da germinação de sementes. O nível apropriado de NO3 - poderia melhorar a taxa de germinação das sementes de quinoa, promover a decomposição e utilização de proteína solúvel e ABA, aumentar o nível de expressão de CqNLP1 e CYP707A2 durante a germinação. A concentração ideal de NO3 - para promover a germinação das sementes é de 1 mM. RESUMO Chenopodium ambientes estudo regulada CqNLP sp NO analisada nlp81 nlp nlp8 nlp8- nlp82 2 ABA CYPA CYP CYP707A mM

ABSTRACT Introduction: Knockdown of fat mass and obesity-associated gene (FTO) can induce N6-methyladenosine (m 6A) ribonucleic acid (RNA) methylation. The objective of this study was to explore the effect of m 6A RNA methylation on atherosclerotic vulnerable plaque by FTO knockdown. Methods: A total of 50 New Zealand white rabbits were randomly divided into pure high-fat group, sham operation group, vulnerable plaque group, empty load group, and FTO knockdown group (10 rabbits/group). Results: Flow cytometry showed that helper T (Th) cells in the FTO knockdown group accounted for a significantly higher proportion of lymphocytes than in the vulnerable plaque group and empty load group (P<0.05). Th cells were screened by cell flow. The level of m 6A RNA methylation in the FTO knockdown group was significantly higher than in the vulnerable plaque group and empty load group (P<0.05). The levels of total cholesterol, triglyceride, and low-density lipoprotein C were higher at the 12th week than at the 1st week, but the high-density lipoprotein C level was lower at the 12th week than at the 1st week. At the 12th week, the interleukin-7 level was significantly lower in the adeno-associated virus-9 (AVV9)-FTO short hairpin RNA group than in the control and AVV9-green fluorescent protein groups (P<0.001). Conclusion: After successfully establishing a vascular parkinsonism rabbit model, m 6A RNA methylation can decrease Th cells and vulnerable atherosclerotic plaques. Introduction obesityassociated obesity associated (FTO N6methyladenosine Nmethyladenosine N6 methyladenosine N (RNA Methods 5 highfat high 10 (1 rabbits/group. rabbitsgroup rabbits/group . rabbits/group) Results (Th P<0.05. P005 P P<0.05 0 05 (P<0.05) flow cholesterol triglyceride lowdensity low density th st highdensity interleukin7 interleukin 7 interleukin- adenoassociated adeno virus9 virus 9 virus- AVV9FTO AVVFTO AVV9 AVV AVV9green AVVgreen green P<0.001. P0001 P<0.001 001 (P<0.001) Conclusion model plaques 1 ( P00 P<0.0 (P<0.05 P000 P<0.00 00 (P<0.001 P0 P<0. (P<0.0 (P<0.00 P<0 (P<0. P< (P<0 (P< (P

Abstract Background: Conotoxins exhibit great potential as neuropharmacology tools and therapeutic candidates due to their high affinity and specificity for ion channels, neurotransmitter receptors or transporters. The traditional methods to discover new conotoxins are peptide purification from the crude venom or gene amplification from the venom duct. Methods: In this study, a novel O1 superfamily conotoxin Tx6.7 was directly cloned from the genomic DNA of Conus textile using primers corresponding to the conserved intronic sequence and 3’ UTR elements. The mature peptide of Tx6.7 (DCHERWDWCPASLLGVIYCCEGLICFIAFCI) was synthesized by solid-phase chemical synthesis and confirmed by mass spectrometry. Results: Patch clamp experiments on rat DRG neurons showed that Tx6.7 inhibited peak calcium currents by 59.29 ± 2.34% and peak potassium currents by 22.33 ± 7.81%. In addition, patch clamp on the ion channel subtypes showed that 10 μM Tx6.7 inhibited 56.61 ± 3.20% of the hCaV1.2 currents, 24.67 ± 0.91% of the hCaV2.2 currents and 7.30 ± 3.38% of the hNaV1.8 currents. Tx6.7 had no significant toxicity to ND7/23 cells and increased the pain threshold from 0.5 to 4 hours in the mouse hot plate assay. Conclusion: Our results suggested that direct cloning of conotoxin sequences from the genomic DNA of cone snails would be an alternative approach to obtaining novel conotoxins. Tx6.7 could be used as a probe tool for ion channel research or a therapeutic candidate for novel drug development. Background channels transporters duct Methods study O Tx67 Tx Tx6 7 Tx6. 3 elements DCHERWDWCPASLLGVIYCCEGLICFIAFCI (DCHERWDWCPASLLGVIYCCEGLICFIAFCI solidphase solid phase spectrometry Results 5929 59 29 59.2 234 2 34 2.34 2233 22 33 22.3 781 81 7.81% addition 1 5661 56 61 56.6 320 20 3.20 hCaV12 hCaV hCaV1 hCaV1. 2467 24 67 24.6 091 0 91 0.91 hCaV22 hCaV2 hCaV2. 730 30 7.3 338 38 3.38 hNaV18 hNaV hNaV1 8 hNaV1. ND723 ND ND7 23 ND7/2 05 5 0. assay Conclusion development 592 59. 2.3 223 22. 78 7.81 566 6 56. 32 3.2 246 24. 09 9 0.9 73 7. 3.3 ND72 ND7/ 2. 7.8 3.

Abstract Voriconazole increases tacrolimus blood concentration significantly when coadministrated. The recommendation of reducing tacrolimus to 1/3 in voriconazole package insert seems not to be satisfactory in clinical practice. In vitro studies demonstrated that the magnitude of inhibition depends on the concentration of voriconazole, while voriconazole exposure is determined by the genotype status of CYP2C19. CYP2C19 gene polymorphism challenges the management of drug-drug interactions(DDIs) between voriconazole and tacrolimus. This work aimed to predict the impact of CYP2C19 polymorphism on the DDIs by using physiologically based pharmacokinetics (PBPK) models. The precision of the developed voriconazole and tacrolimus models was reasonable by evaluating the pharmacokinetic parameters fold error, such as AUC0-24, Cmax and tmax. Voriconazole increased tacrolimus concentration immediately in all population. The simulated duration of DDIs disappearance after voriconazole withdrawal were 146h, 90h and 66h in poor metabolizers (PMs), intermediate metabolizers (IMs) and extensive metabolizers(EMs), respectively. The developed and optimized PBPK models in this study can be applied to assit the dose adjustment for tacrolimus with and without voriconazole. coadministrated 13 1 3 1/ practice CYPC CYP C CYP2C1 drugdrug drug interactionsDDIs interactions interactions(DDIs (PBPK error AUC024, AUC024 AUC AUC0 24, 24 AUC0-24 tmax population 146h h PMs, PMs , (PMs) IMs (IMs metabolizersEMs, metabolizersEMs EMs metabolizers(EMs) respectively CYP2C AUC02 2 AUC0-2 (PMs metabolizers(EMs AUC0-

ABSTRACT Herein, we examined the protective effect of metoprolol combined with atractylenolide I (Atr I) in acute myocardial infarction (AMI) by regulating the SIRT3 (silent information regulator 3)/β-catenin/peroxisome proliferator-activated receptor gamma (PPAR-γ) signaling pathway. Briefly, 50 rats were randomly divided into the sham operation, model, metoprolol, Atr I, and combination metoprolol with Atr I groups (combined treatment group). The AMI model was established by ligating the left anterior descending coronary artery. After treatment, infarct size, histopathological changes, and cell apoptosis were examined using 2,3,5-triphenyltetrazolium chloride staining, hematoxylin-eosin staining, and the TUNEL assay. The left ventricular ejection fraction (LVEF), left ventricular fraction shortening (LVFS), and left ventricular mass index (LVMI) were detected by echocardiography. Endothelin-1 (ET-1), nitric oxide (NO), tumor necrosis factor-alpha (TNF-α), and interleukin-6 (IL-6) levels were detected using enzyme-linked immunosorbent assays. Furthermore, we measured lactate dehydrogenase (LDH), creatine kinase (CK) isoenzyme (CK-MB), and CK levels. Western blotting was performed to determine the expression of SIRT3, β-catenin, and PPAR-γ. Herein, the combined treatment group exhibited increased levels of LVEF, LVFS, and NO, whereas LVMI, ET-1, TNF-α, IL-6, LDH, CK-MB, and CK levels were decreased. Importantly, the underlying mechanism may afford protection against AMI by increasing the expression levels of SIRT3, β-catenin, and PPAR-γ. Herein (AMI SIRT silent 3/βcatenin/peroxisome 3βcateninperoxisome βcateninperoxisome 3 /β catenin/peroxisome β catenin peroxisome proliferatoractivated proliferator activated PPARγ PPAR γ (PPAR-γ pathway Briefly 5 operation group. . group) artery size changes 2,3,5triphenyltetrazolium 235triphenyltetrazolium triphenyltetrazolium 2,3,5 2 staining hematoxylineosin hematoxylin eosin assay LVEF , (LVEF) LVFS (LVFS) LVMI (LVMI echocardiography Endothelin1 Endothelin 1 Endothelin- ET1, ET1 ET (ET-1) NO (NO) factoralpha factor alpha TNFα, TNFα TNF α (TNF-α) interleukin6 interleukin 6 interleukin- IL6 IL (IL-6 enzymelinked enzyme linked assays Furthermore LDH (LDH) (CK CKMB, CKMB MB (CK-MB) βcatenin, βcatenin catenin, β-catenin PPARγ. γ. PPAR-γ 1, ET-1 α, TNF-α IL6, 6, IL-6 MB, CK-MB decreased Importantly cateninperoxisome 5triphenyltetrazolium 235 2,3, (LVEF (LVFS (ET-1 (NO (TNF-α (IL- (LDH (CK-MB ET- IL- 23 2,3 (ET- (IL 2, (ET

Abstract Background: Bungarus multicinctus is one of the most dangerous venomous snakes prone to cardiopulmonary damage with extremely high mortality. In our previous work, we found that glutamine (Gln) and glutamine synthetase (GS) in pig serum were significantly reduced after Bungarus multicinctus bite. In the present study, to explore whether there is a link between the pathogenesis of cardiopulmonary injury and Gln metabolic changes induced by Bungarus multicinctus venom. We investigated the effect of Gln supplementation on the lung and heart function after snakebite. Methods: We supplemented different concentrations of Gln to mice that were envenomated by Bungarus multicinctus to observe the biological behavior, survival rate, hematological and pathological changes. Gln was supplemented immediately or one hour after the venom injection, and then changes in Gln metabolism were analyzed. Subsequently, to further explore the protective mechanism of glutamine on tissue damage, we measured the expression of heat-shock protein70 (HSP70), NF-κB P65, P53/PUMA by western blotting and real-time polymerase in the lung and heart. Results: Gln supplementation delayed the envenoming symptoms, reduced mortality, and alleviated the histopathological changes in the heart and lung of mice bitten by Bungarus multicinctus. Additionally, Gln increased the activity of glutamine synthetase (GS), glutamate dehydrogenase (GDH) and glutaminase (GLS) in serum. It also balanced the transporter SLC7A11 expression in heart and lung tissues. Bungarus multicinctus venom induced the NF-κB nuclear translocation in the lung, while the HO-1 expression was suppressed. At the same time, venom activated the P53/PUMA signaling pathway and the BAX expression in the heart. Gln treatment reversed the above phenomenon and increased HSP70 expression. Conclusion: Gln alleviated the glutamine metabolism disorder and cardiopulmonary damage caused by Bungarus multicinctus venom. It may protect lungs and heart against venom by promoting the expression of HSP70, inhibiting the activation of NF-κB and P53/PUMA, thereby delaying the process of snake venom and reducing mortality. The present results indicate that Gln could be a potential treatment for Bungarus multicinctus bite. Background mortality work (Gln GS (GS bite study snakebite Methods behavior rate injection analyzed Subsequently heatshock heat shock protein protein7 HSP , (HSP70) NFκB NF κB P65 P P53PUMA PPUMA P53 PUMA realtime real time Results symptoms Additionally GS, GDH (GDH GLS (GLS SLCA SLC A SLC7A1 tissues HO1 HO 1 HO- suppressed HSP7 Conclusion (HSP70 P6 P5 SLC7A (HSP7 (HSP

ABSTRACT Slot resources are limited and not properly allocated, and the wave-system structures of airlines can organize slot time effectively. The article identifies and evaluates the wave-system structure of Beijing Daxing International Airport and Beijing Capital International Airport. It is found that: the wave-system of Beijing Capital International Airport is more obvious than that of Beijing Daxing International Airport, and the density and amplitude of waves are higher in summer and autumn than in winter and spring; the system waveforms of both Daxing Airport and Capital Airport are in the shape of morning and evening peaks; the indirect connection quality of flights from different departure airports via Capital Airport is higher than that of Daxing Airport; the indirect connections to destination airports via the two airports in Beijing are uneven in spatial distribution. The spatial distribution of indirect connections to destination airports via the two airports is uneven, but the wave-system plays a significant role in connecting small and medium-sized regional airports. allocated wavesystem wave effectively spring peaks mediumsized medium sized