Abstract Background Fibrous scars frequently form at the sites of bone nonunion when attempts to repair bone fractures have failed. However, the detailed mechanism by which fibroblasts, which are the main components of fibrous scars, impede osteogenesis remains largely unknown. Results In this study, we found that fibroblasts compete with osteogenesis in both human bone nonunion tissues and BMP2-induced ectopic osteogenesis in a mouse model. Fibroblasts could inhibit the osteoblastic differentiation of mesenchymal stem cells (MSCs) via direct and indirect cell competition. During this process, fibroblasts modulated the nuclear-cytoplasmic shuttling of YAP in MSCs. Knocking down YAP could inhibit osteoblast differentiation of MSCs, while overexpression of nuclear-localized YAP-5SA could reverse the inhibition of osteoblast differentiation of MSCs caused by fibroblasts. Furthermore, fibroblasts secreted DKK1, which further inhibited the formation of calcium nodules during the late stage of osteogenesis but did not affect the early stage of osteogenesis. Thus, fibroblasts could inhibit osteogenesis by regulating YAP localization in MSCs and secreting DKK1. Conclusions Our research revealed that fibroblasts could modulate the nuclear-cytoplasmic shuttling of YAP in MSCs, thereby inhibiting their osteoblast differentiation. Fibroblasts could also secrete DKK1, which inhibited calcium nodule formation at the late stage of osteogenesis. failed However unknown study BMP2induced BMPinduced BMP2 induced BMP model (MSCs competition process nuclearcytoplasmic nuclear cytoplasmic nuclearlocalized localized YAP5SA YAPSA 5SA SA Furthermore DKK1 DKK Thus

Abstract Background: immunonutrition has been introduced and proposed to have positive modulating effects on inflammatory and immune responses in surgical patients. This meta-analysis aimed to assess whether perioperative enteral immunonutrition (EIN) can reduce postoperative complications or reduce inflammatory responses in esophageal cancer (EC) patients undergoing esophagectomy. Methods: PubMed, Embase, Web of science, EBSCO, and Cochrane library databases were systematically searched. Randomized controlled trials (RCTs) assessing the effect of EIN before and/or after surgery in EC patients undergoing esophagectomy were identified. Two investigators independently searched articles, extracted data, and assessed the quality of included studies. Results: ten RCTs involving 1,052 patients were included in the meta-analysis, including 573 patients in the EIN group and 479 patients in the enteral nutrition (EN) group. Overall, no significant difference was observed between the two groups in the incidence of postoperative pneumonia, surgical site infection, intra-abdominal abscess, septicemia, and urinary tract infection. No significant incidence of postoperative anastomotic leakage, acute respiratory distress syndrome (ARDS), and in-hospital mortality was found. Conclusions: perioperative enteral immunonutrition did not reduce the incidence of infectious complications and anastomotic leakage in EC patients undergoing esophagectomy, nor did it reduce postoperative CRP and IL-6, but did not increase in-hospital mortality.

Resumen Antecedentes: se ha introducido y propuesto la inmunonutrición para regular activamente la inflamación y la respuesta inmune en pacientes quirúrgicos. El presente metaanálisis fue diseñado para evaluar si la inmunonutrición enteral perioperatoria (EIN, por sus siglas en inglés) puede reducir las complicaciones postoperatorias o la inflamación en pacientes con cáncer de esófago (CE) sometidos a esofagectomía. Métodos: se realizó una búsqueda sistemática en las bases de datos de PubMed, Embase, Web of Science, EBSCO y Cochrane Library. Se evaluó el efecto de la EIN preoperatoria y/o postoperatoria en un ensayo aleatorizado controlado (RCT) en pacientes con cáncer de esófago sometidos a esofagectomía. Dos investigadores buscaron independientemente artículos, extrajeron datos y evaluaron la calidad de los artículos incluidos. Resultados: el metanálisis incluyó diez ensayos controlados aleatorios en los que participaron 1.052 pacientes, de los cuales 573 fueron incluidos en el grupo EIN y 479, en el grupo de nutrición enteral (NE). En general, no hubo diferencia significativa en la incidencia de neumonía postoperatoria, infección del sitio quirúrgico, absceso intraperitoneal, sepsis e infección del tracto urinario entre los dos grupos. No hubo diferencia significativa en la incidencia de fístula anastomótica postoperatoria, síndrome de distrés respiratorio agudo (SDRA) y mortalidad hospitalaria. Conclusión: la inmunonutrición enteral perioperatoria no puede reducir la incidencia de complicaciones infecciosas postoperatorias y fístulas anastomóticas, ni la PCR postoperatoria ni la IL-6. Pero no aumentó la mortalidad hospitalaria.

ABSTRACT The present work intends to verify the need for a dictionary (Spanish-Chinese) specialized in teaching and learning of language and culture, and to reflect on the innovations of structure and functions that are required for the elaboration of dictionaries, in the context of media convergence. Through a survey based on two questionnaires, the practices, needs and lexicographical expectations of Chinese students, in terms of their learning of the language and culture, have been observed. From the results obtained, it can be deduced that no dictionary available to students integrates everything necessary for its use and cultural/pragmatic information, and multimedia or multimodality resources are the aspects least addressed in current dictionaries. The results also show that the need to be able to communicate with the editor and lexicographical, the function of linking relative information by establishing links and relationships between different concepts, and the inclusion of exhaustive information and of different modalities in each entry, as well as the accessibility and ease of handling, are the features that students believe dictionaries should have properly today. For this reason, in this work, the need and tendency to apply media convergence to the design of dictionary structure have also been verified with the expectation of applying this technology in future lines of research.

RESUMEN El presente trabajo pretende comprobar la necesidad de un diccionario (español-chino) especializado en enseñanza-aprendizaje de la lengua y cultura, y reflexionar las innovaciones de estructura y funciones que se requieren para la elaboración de diccionarios en el contexto de la convergencia mediática. Mediante un sondeo basado en dos cuestionarios se han observado las prácticas, necesidades y expectativas lexicográficas de los estudiantes chinos en cuanto a su aprendizaje de la lengua y cultura. De los resultados obtenidos se desprende que ningún diccionario de los que disponen los alumnos integra todo lo necesario para su uso y que la información cultural y pragmática y los recursos de multimedia o multimodalidad son los aspectos que menos se abordan en los diccionarios actuales. Los resultados también muestran la necesidad de poder comunicar con el editor y lexicográfico, la función de enlazar información relativa, estableciendo vínculos y relaciones entre distintos conceptos, y la inclusión de información exhaustiva y de distintas modalidades en cada entrada, así como la accesibilidad y la facilidad de manejo son las características que los estudiantes creen que deben tener debidamente los diccionarios en la actualidad. Por ello, en este trabajo se ha comprobado la necesidad y tendencia de aplicar la convergencia mediática al diseño de la estructura del diccionario con la expectativa de aplicar esa tecnología en futuras líneas de investigación.

BACKGROUND: There is no current active or passive disease surveillance programme focused on schools in South Africa (SA). As such, the country is missing an opportunity to rapidly and effectively flag and address pathogen outbreaks, for example SARS-CoV-2, in a key closed setting. Furthermore, the role of school transmission in the spread of the SARS-CoV-2 virus within communities is uncertain OBJECTIVE: This pilot study, conducted during March 2022 in Cape Town, aimed to indicate the feasibility of conducting intense active contact-tracing in a school environment prior to a large national study to compare school v. community SARS-CoV-2 transmission risk METHODS: We conducted a pilot school-level case-ascertained prospective study with a component of enhanced surveillance. Following study initiation, the first learner at a participating school who tested SARS-CoV-2 positive (via polymerase chain reaction (PCR) or a rapid antigen test (RAT)) was invited to join the study as the index case and all their school-based close contacts were followed up telephonically, monitored for symptoms for 14 days, and tested using PCR if any symptoms were reported RESULTS: On 8 March 2022, a student with RAT laboratory-confirmed COVID-19 was identified and they and their guardian consented to participate as the index case. Of the 11 eligible close contacts, six provided consent/assent and completed symptom-monitoring calls until the end of the 14-day study period. The secondary attack rate (SAR) was 2/11 (18.18%) of all close contacts who were at risk of infection, 2/4 (50.0%) of all those close contacts who developed symptoms, and 2/4 (50.0%) of all those close contacts who developed symptoms and were tested for SARS-CoV-2. During the same period, the school reported that 9 of the 926 learner body tested COVID-19 positive (0.97%). Total hours spent conducting monitoring for 6 learners was 27 hours, with each learner requiring approximately 4.5 hours of contact time during the study period CONCLUSION: This is the first SA school-based COVID-19 transmission study, the results of which can inform national discussions regarding the role of schools and school-based active and passive surveillance in pathogen prevention and control

RESUMO: A eliminação da pobreza e da fome em todas as suas formas e dimensões é um dos principais objetivos do desenvolvimento sustentável global (GSD). Este artigo analisa as características da divulgação da literatura, o progresso da pesquisa e as tendências de fronteira no campo do combate à pobreza nos últimos dez anos por meio de bibliometria e visualização de informações. Uso do CiteSpace para analisar a literatura sobre combate à pobreza nas principais revistas da Web of Science e Scopus (W&S) e da China National Knowledge Infrastructure (CNKI). Os resultados mostram que: (1) O calor da pesquisa anti-pobreza está aumentando tanto na W&S quanto na CNKI, a taxa de crescimento da literatura chinesa publicada é significativamente maior do que a da literatura inglesa após 2015, mas a influência internacional não é suficiente; (2) Pesquisadores e instituições em W&S são mais independentes do que na CNKI; a equipe de pesquisa chinesa é mais estável e maior, mas precisa ser fortalecida ainda mais na pesquisa interinstitucional e interdisciplinar; (3) O conteúdo da pesquisa em W&S concentra-se principalmente nos fatores que influenciam e nos mecanismos de redução da pobreza, serviços ecossistêmicos, saúde materna e desenvolvimento sustentável. De acordo com a China National Knowledge Infrastructure (CNKI), a China prestou mais atenção a formas concretas de reduzir a pobreza e, após completar a luta contra a pobreza absoluta até 2020, a China prestará mais atenção à redução da pobreza relativa e resolverá os problemas de pobreza multidimensional em melhorar a segurança dos cuidados médicos, educação e condições de habitação.

ABSTRACT: The elimination of poverty and hunger in all its forms and dimensions is one of the key objective of global sustainable development (GSD). This paper analyzed the characteristics of literature release, research progress and frontier trends in the field of anti-poverty in the past ten years by means of bibliometrics, and information visualization. Using CiteSpace to analyze the literature on anti-poverty in the core journals of Web of Science and Scopus (W&S), and China National Knowledge Infrastructure (CNKI). The results showed that:(1) The heat of anti-poverty research is on the rise in both W&S and CNKI, the growth rate of Chinese literature published is significantly higher than that of English literature after 2015, but the international influence is not enough. (2) Researchers and institutions in W&S are more independent than in CNKI. The Chinese research team is more stable and larger, but it needs to be further strengthened in cross-institutional and interdisciplinary research. (3)The research content in W&S mainly focuses on influencing factors and poverty reduction mechanisms, ecosystem services, maternal health and sustainable development. According to the China National Knowledge Infrastructure (CNKI), China paid more attention to concrete ways to reduce poverty, and after completing the fight against absolute poverty by 2020, China will pay more attention to reducing relative poverty and solve multi-dimensional poverty problems by improving the security of medical care, education and housing conditions.

Abstract The differences of volatile odorants of rice at different roasting levels were analyzed by headspace-gas chromatography-ion mobility spectrometry (HS-GC-IMS) using fingerprints combined with principal component analysis (PCA). GC-IMS and PCA could distinguish the different roasting levels of rice and the results showed that a total of 47 representative flavor compounds were detected in four samples from all roasting stages. The aroma components of roasted rice are mainly aldehydes and ketones, furans and pyrroles, as well as a large number of phenols, esters and alcohols, which make up the special aroma flavor of roasted rice. It can be seen that the flavor characteristics of roasted rice can be reflected more fully when the rice is roasted in medium (18 min), and can have more fruit wood, cream and roasted aromas. The PCA based on the signal intensity of the detected volatile compounds revealed effective differentiation of samples from different stages into comparatively independent spaces. Thus, the differences of volatile compounds from different roasting stages of rice were determined, and the flavor fingerprints of that can be successfully established using HS-GC-IMS and PCA.

Abstract Mesenchymal stem cells-derived exosomes (MSCs-exosomes) reportedly possess cardioprotective effects. This study investigated the therapeutic potential and mechanisms of MSCs-exosomes on heart failure (HF). H9c2 cells were used to establish a cardiomyocyte hypertrophy model by angiotensin II (Ang II) treatment. Isolated MSCs-exosomes were identified by transmission electron microscope and CD63 detection. Apoptosis rate was measured by terminal deoxynucleotidyl transferase (TdT) dUTP Nick-End Labeling (TUNEL) assay. Levels of inflammatory factors [interleukin (IL)-1β, IL-4, IL-6, and tumor necrosis factor (TNF)-α] and brain natriuretic peptide (BNP) were determined by ELISA. Expression of apoptosis-related proteins [Bax, B-cell lymphoma-2 (Bcl-2), and caspase 3] and Hippo-Yes-associated protein (YAP) pathway-related proteins [YAP, phosphor (p)-YAP, and tafazzin (TAZ)] was detected by western blotting. Cardiomyocyte hypertrophy of H9c2 cells induced by Ang II was ameliorated by MSCs-exosomes treatment. MSCs-exosomes downregulated Bax and caspase 3 levels and upregulated Bcl-2 level in Ang II-induced H9c2 cells. MSCs-exosomes also reduced the levels of BNP, IL-1β, IL-4, IL-6, and TNF-α in Ang II-induced H9c2 cells. Meanwhile, p-YAP was downregulated and TAZ was upregulated after MSCs-exosomes administration. In conclusion, MSCs-exosomes alleviate the apoptosis and inflammatory response of cardiomyocyte via deactivating Hippo-YAP pathway in HF.

As an important component of solid tumors, mast cells show specific phenotypes in various tumor microenvironments. However, the precise mechanism of mast cell accumulation and the phenotypic features of thyroid cancer (TC) remain largely unknown. Here, we found that mast cells were obviously recruited to tumor tissue by TC-derived stem cell factor (SCF). With tumor progression, mast cell levels increased gradually. In addition, intratumoral mast cells expressed higher levels of the immunosuppressive molecule galectin-9, which effectively suppresses CD8+ T-cell antitumor immunity in vitro. Blocking galectin-9 on tumor-infiltrating mast cells reversed the immunosuppression of CD8+ T cells. In conclusion, our data elucidated novel protumorigenic and immunosuppressive roles of mast cells in TC. In addition, our results indicated that blocking mast cells may impede tumor progression and ameliorate the prognosis of TC patients.

Abstract In order to explore the efficient investigate and utilization of emulsion produced by enzyme-assisted aqueous extraction of walnut oil, the effects of different enzyme treatment (including Alcalase 2.4L, Ban 480L α-amylase, Neutrase 0.8L, Pectinex SP-L, Celluclast 1.5L) on the characteristics of emulsion were studied to characterize its emulsifying characteristics The emulsion composition, particle size distribution, Zeta potential, rheological properties and protein surface hydrophobicity of emulsion were determined to characterize its emulsifying properties. The results showed that the particle size of the emulsion obtained from enzymatic hydrolysis showed a smaller trend and the absolute value of Zeta potential showed a larger trend in the presence of enzymes. On emulsion protein, hydrophobicity of emulsion protein was obtained by hydrolysis with different enzymes showed that the trend followed the order: Celluclast 1.5L> Ban 480L >Neutrase 0.8L >Pectinex SP-L >control> Alcalase 2.4L. The particle size, zeta potential, ability to increase emulsion viscosity and interfacial hydrophobicity of emulsion proteins affected the emulsion physical stability and the effect of demulsification. The results of rheological analysis show that emulsions from Ban 480L α-amylase, Neutrase 0.8L and Celluclast 1.5L hydrolysate still maintained their elastic structure damaged by shear rate and were more stable, and the emulsions obtained by Alcalase 2.4L and Pectinex SP-L were unstable which was easy to be broken.

Abstract To study the effect of Jiawei Huangqi Guizhi Decoction on gastrointestinal hormones and TGF-β3 signal pathways in rats with chronic atrophic gastritis (CAG). The model was created by methylnitrosoguanidine (MNNG) comprehensive method. After successful modeling, it was divided into three groups: model group (MC group), frolic acid group (AC group), modified Huangqi Guizhi Decoction high dose group (HH group), modified Huangqi Guizhi Decoction middle dose group (HM group), and modified Huangqi Guizhi Decoction low dose group (HL group). Gastric pathology was observed by HE staining. The levels of gastrin (GAS) and motilin (MTL) in rat serum were detected by ELISA assay. After HE staining, the histopathological sections were analyzed. Inflammatory factors infiltration and disorder of mucosal epithelial cells were found in the model group, which were improved to some extent after administration. According to the pathological chart analysis and score of rats in each group, compared with the model group, the gastric tissue damage of rats in each administration group has been improved in different degrees, among which the pathological scores of HH and HM groups were lower, and the corresponding damage degree was smaller. According to the test results of ELISA, Jiawei Huangqi Guizhi Decoction could reduce the contents of GAS, TGF-β3, and increase MTL abundance in the serum of rats, thus accelerating the apoptosis of tumor cells and inhibiting cancer. Jiawei Huangqi Guizhi Decoction played a positive role in preventing the occurrence of gastric cancer through reducing the concentrations of GAS and TGF-β3 in serum, and increasing the concentration of MLT in serum. This results provided a new treatment idea for CAG.

Abstract Objectives: Although miR-653-5p has been validated to participate in the progression of multiple types of cancer, the functional role of exosomal miR-653-5p derived from Mesenchymal Stem Cells (MSCs) in Laryngeal Papilloma (LP) has still remained elusive. Hence, this study aimed to investigate the role of MSCs-derived exosomal miR-653-5p in LP. Methods: LP tissues (n = 15) and adjacent normal tissues (n = 10) were collected to examine the expression level of miR-653-5p. The expression level of miR-653-5p in LP cells and normal cells was also detected. Then, miR-653-5p was overexpressed or silenced to explore its effects on the proliferation, migration, invasion, and apoptosis of LP cells. Thereafter, the effects of exosomal miR-653-5p derived from MSCs on LP cell progression and the potential regulatory mechanism of miR-653-5p were assessed. Results: It was revealed that the expression level of miR-653-5p was downregulated in LP tissues and cells. In addition, miR-653-5p suppressed the proliferation, migration, invasion, and apoptosis of LP cells. Exosomes derived from MSCs played a suppressive role in LP development and mediated the transmission of miR-653-5p to LP cells. Further exploration identified Basic leucine Zipper and W2 domains 2 (BZW2) as the target of miR-653-5p. More importantly, the rescue experiments revealed that MSCs-secreted exosomal miR-653-5p efficiently inhibited the aggressive phenotypes of LP cells, which could be significantly reversed by BZW2 overexpression in LP cells. Conclusion: MSCs-derived exosomal miR-653-5p exerted inhibitory effects on LP progression through targeting BZW2, which provided a novel idea for the therapy of LP. Clinical Trial registration number: chictr-ior-17011021.

Abstract RFX2 plays critical roles in mammalian spermatogenesis and cilium maturation. Here, the testes of 12-month-old adult boars of Banna mini-pig inbred line (BMI) were subjected to whole-transcriptome sequencing. The results indicated that the average expression (raw count) of RFX2 gene in BMI testes was 16138.25, and the average expression value of the corresponding transcript ENSSSCT00000043271.2 was 123.1898. The CDS of RFX2 obtained from BMI testes was 2,817 bp (GenBank accession number: OL362242). Gene structure analysis showed that RFX2 was located on chromosome 2 of the pig genome with 19 exons. Protein structure analysis indicated that RFX2 contains 728 amino acids with two conserved domains. Phylogenetic analysis revealed that RFX2 was highly conserved with evolutionary homologies among mammalian species. Other analyses, including PPI networks, KEGG, and GO, indicated that BMI RFX2 had interactions with 43 proteins involving various functions, such as in cell cycle, spermatid development, spermatid differentiation, cilium assembly, and cilium organization, etc. Correlation analysis between these proteins and the transcriptome data implied that RFX2 was significantly associated with FOXJ1, DNAH9, TMEM138, E2F7, and ATR, and particularly showed the highest correlation with ATR, demonstrating the importance of RFX2 and ART in spermatogenesis. Functional annotation implied that RFX2 was involved in 17 GO terms, including three cellular components (CC), six molecular functions (MF), and eight biological processes (BP). The analysis of miRNA-gene targeting indicated that BMI RFX2 was mainly regulated by two miRNAs, among which four lncRNAs and five lncRNAs competitively bound ssc-miR-365-5p and ssc-miR-744 with RFX2, respectively. Further, the dual-luciferase report assay indicated that the ssc-miR-365-5p and ssc-miR-744 significantly reduced luciferase activity of RFX2 3'UTR in the 293T cells, suggesting that these two miRNAs regulated the expression of RFX2. Our results revealed the important role of RFX2 in BMI spermatogenesis, making it an intriguing candidate for follow-up studies.

ABSTRACT Apple cultivars in Korea have been experiencing poor fruit sets due to early spring low temperatures and global warming. Therefore, the present study aimed to investigate the effects of temperature on fruit setting and to select apple cultivars tolerant to extreme temperatures based on the temperature response of their pollen. The effect of temperature on pollen germination percentage (PGP) and on pollen tube length (PTL) was determined under laboratory conditions using the pollen of ten apple cultivars. The two parameters were evaluated using a pollen germination medium, at temperatures ranging from 5 to 45 °C, at 5 °C intervals. The temperature variations considerably affected pollen germination and tube growth in all the examined cultivars. The maximum pollen germination percentage ranged from 61.5 (“Green Ball”) to 99.9% (“Shinano Gold”) with a mean of 85.2%, whereas the maximum pollen tube length ranged from 716.5 (“Tsugaru”) to 989.8 µm (“Arisoo”) with mean of 855.1 µm. There were differences in the cardinal temperatures (Tmin, Topt, and Tmax) of PGP and PTL between cultivars. Mean cardinal temperatures Tmin, Topt, and Tmax computed using the modified bilinear model were 4, 27.7, and 44.9 °C and 6.3, 28.6, and 43.7 °C for PGP and PTL, respectively. Our preliminary results may be used to select low-temperature and global warming-friendly apple cultivars for farmers and can also be exploited to develop temperature-tolerant apple cultivars during flowering.

Abstract Background: Conotoxins exhibit great potential as neuropharmacology tools and therapeutic candidates due to their high affinity and specificity for ion channels, neurotransmitter receptors or transporters. The traditional methods to discover new conotoxins are peptide purification from the crude venom or gene amplification from the venom duct. Methods: In this study, a novel O1 superfamily conotoxin Tx6.7 was directly cloned from the genomic DNA of Conus textile using primers corresponding to the conserved intronic sequence and 3’ UTR elements. The mature peptide of Tx6.7 (DCHERWDWCPASLLGVIYCCEGLICFIAFCI) was synthesized by solid-phase chemical synthesis and confirmed by mass spectrometry. Results: Patch clamp experiments on rat DRG neurons showed that Tx6.7 inhibited peak calcium currents by 59.29 ± 2.34% and peak potassium currents by 22.33 ± 7.81%. In addition, patch clamp on the ion channel subtypes showed that 10 μM Tx6.7 inhibited 56.61 ± 3.20% of the hCaV1.2 currents, 24.67 ± 0.91% of the hCaV2.2 currents and 7.30 ± 3.38% of the hNaV1.8 currents. Tx6.7 had no significant toxicity to ND7/23 cells and increased the pain threshold from 0.5 to 4 hours in the mouse hot plate assay. Conclusion: Our results suggested that direct cloning of conotoxin sequences from the genomic DNA of cone snails would be an alternative approach to obtaining novel conotoxins. Tx6.7 could be used as a probe tool for ion channel research or a therapeutic candidate for novel drug development.

Abstract Introduction Transition periods are integral parts of a person’s life span, characterized by phases of life and shifts in activity before adapting to new situations. Objectives This study aims to understand the high potential characteristics of students with disabilities and evaluate the roles of school-based occupational therapists (SBOT) in assisting these students during transition periods. Method This study comprised 196 students and five SBOT. Research instruments included a characteristic checklist for potential learners and an in-depth interview methodology. The checklist, developed from related literature, consisted of three domains: physical and socio-emotional health, self-determination, and communication and academic performance. Students’ performance levels were rated by teachers, with high potential characteristics being defined as achieving an average total score ≥2.0, without obtaining a zero in any checklist item. Results Most participants achieved full scores for high potential characteristics in the physical and socio-emotional health domain. Most SBOT provided direct, indirect, and integrated services using various service delivery models that were tailored to different types of disabilities. Conclusion This study provides fundamental information for SBOT and school professionals to foster high-potential characteristics in students with disabilities during transition periods. Suitable services in the domains of physical and socio-emotional health, self-determination, and communication and academic performance can enhance these high-potential characteristics.

Resumo Introdução O período de transição é parte natural da vida de uma pessoa. Pode ser classificado por fases da vida e mudança de atividade antes de entrar em novas situações. Objetivos Explorar características de alto potencial de alunos com deficiência e investigar os serviços de terapeutas ocupacionais escolares (SBOTs) para esses alunos durante os períodos de transição. Método Participaram 196 alunos e 5 SBOTs. Os instrumentos de pesquisa compreenderam o checklist característico dos potenciais aprendizes e uma entrevista em profundidade. A lista de verificação foi desenvolvida pela literatura relacionada e consistia em três domínios, incluindo saúde física e socioemocional, autodeterminação e comunicação e desempenho acadêmico. A pontuação do nível de desempenho dos alunos foi avaliada pelos professores. As características de alto potencial dos estudantes deste estudo significaram a obtenção de pontuação total média igual ou superior a 2,0, não tendo tido nenhum zero em qualquer item avaliado pelo checklist. Resultados A maioria dos participantes atingiu a pontuação completa das características de alto potencial no domínio saúde física e socioemocional. A maioria das SBOTs prestava serviços diretos, indiretos e integrados com base em diversos modelos de prestação de serviços diferenciados para cada tipo de deficiência. Conclusão Este estudo fornece informações fundamentais para SBOTs e profissionais escolares a fim de estimular características de alto potencial em alunos com deficiência em períodos de transição. Serviços adequados nas áreas de saúde física e socioemocional, autodeterminação e comunicação e desempenho acadêmico podem aprimorar características de alto potencial para esses estudantes.